PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0057ss02130.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 655aa    MW: 73861.2 Da    PI: 6.0072
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0057ss02130.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.82.8e-24204257155
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Vang0057ss02130.2 204 KARVVWSVDLHQKFVKAVNQI-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 257
                        68*******************.9*******************************8 PP

2Response_reg81.92e-27241321109
                        EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHH CS
       Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedaleal 90 
                        vl+vdD+p+ +++l+++l+k +y ev+++  ++ al+ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + +
  Vang0057ss02130.2  24 VLVVDDDPTWLKILEKMLKKCNY-EVTTCCLARHALNLLRERKdgYDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVMKGV 113
                        89*********************.***************999999**********************6644.8******************* PP

                        HTTESEEEESS--HHHHHH CS
       Response_reg  91 kaGakdflsKpfdpeelvk 109
                        + Ga d+l Kp+ ++el++
  Vang0057ss02130.2 114 QHGACDYLLKPIRMKELRN 132
                        ****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.42E-3521152IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.9E-4421156No hitNo description
SMARTSM004485.6E-3222134IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.32823138IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.7E-2424133IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.10E-2925138No hitNo description
Gene3DG3DSA:1.10.10.603.5E-27202261IPR009057Homeodomain-like
SuperFamilySSF466891.59E-16202259IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-21204257IPR006447Myb domain, plants
PfamPF002492.1E-7206256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
LSLSKMDNGC FSSPRRDFPA GLRVLVVDDD PTWLKILEKM LKKCNYEVTT CCLARHALNL  60
LRERKDGYDI VISDVNMPDM DGFKLLEHVG LEMDLPVIMM SVDGETSRVM KGVQHGACDY  120
LLKPIRMKEL RNIWQHVFRK RIHEAKEFES FESFESIHLM RNGSELSDEG NLFAVEDVTS  180
TKKRKDADNK HDDKECMDPS SAKKARVVWS VDLHQKFVKA VNQIGFDKVG PKKILDLMNV  240
PWLTRENVAS HLQKYRLYLI RIQKENDRRS SSSGMKHSDF PSKDLGSFGF QNPVNKQQND  300
VSTDSYNYSD GSLHLPTVEN KNYEGDKGSV SQFTIAKKGR PLTGNVTDSN MRESSRVGLN  360
QPFAQSEGNH AVFDCSLPTQ YSWTEVPNMQ LKEEHKSLVH LEDSFNQMPL HGKQHHIQVD  420
QSQSVASISS APSITEEEVP ACIEAKPLFS DFKNDRSSSV NSIGNAVDTF PIQPGSLAMN  480
AQSLEPISTT NSGLKAHGYN NLSCISDVEI YQRNLLLGGE AASAPLDEDL HFQWLQGECY  540
NMNFGLQNIG MSEYYDPGLI AEAPSHLYDS ADYSVIDQGL AENSEPRASI TGTTLKRLVY  600
KNGFRTKQCW TKKLKVNFEQ YKGGFDEFPK LLSWTVLELE LAFLTSFGDR DSVGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-17200262163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520235.10.0PREDICTED: two-component response regulator ARR11-like isoform X1
TrEMBLA0A0S3S1710.0A0A0S3S171_PHAAN; Uncharacterized protein
TrEMBLA0A0L9UAK30.0A0A0L9UAK3_PHAAN; Uncharacterized protein
STRINGGLYMA11G37480.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-124response regulator 11